Scaffold : scaffold_27
Gene_id : Plaha_PHALS_09402
Description : hypothetical protein
ATGAACACATCTTTAGCTGTCATCAGCCATGCCCCTCATCGTTTCTTAAGCCTCACCAAAGTTATCAAGTGCTTCTTGGAGCTTAAGCATCCGATAGACA
AGTACTACGATGAAAGGCTACAGCTCTCCAACCTGATGTCGTCTTTGAAGGAGGAGTTAAGGCAACTCTATTCCCTCATTGCCCCGGTGGGAGCGCTGAT
GCAAAAAACTTAAGGTTGCAGCAAGCCCAGTGGTGCCTTCGCTCTACTTGGTCTTGTTGATTTCCAGCTGAACACTATGTCAGCCGCAGCTCCTTTGCAA
GTCACCCGACCTTCAAGAGACAAAAATGGTGAGAGCAAGGAGGACGCATTCTTTGTAGAACACCATATGCTGGAGAAGACTGTACGGAAATTTAGGAGGC
TGATGGAGAAGGCCTTCAAGAAGCGATTCCTTGTCCGCTACGATCACGAGCTGTTTCCCGAGACTTCAACAAAGAAAGACAAAGCCAAATG
	
	
ATGAACACATCTTTAGCTGTCATCAGCCATGCCCCTCATCGTTTCTTAAGCCTCACCAAAGTTATCAAGTGCTTCTTGGAGCTTAAGCATCCGATAGACA
AGTACTACGATGAAAGGCTACAGCTCTCCAACCTGATGTCGTCTTTGAAGGAGGAGTTAAGGCAACTCTATTCCCTCATTGCCCCGCTGAACACTATGTC
AGCCGCAGCTCCTTTGCAAGTCACCCGACCTTCAAGAGACAAAAATGGTGAGAGCAAGGAGGACGCATTCTTTGTAGAACACCATATGCTGGAGAAGACT
GTACGGAAATTTAGGAGGCTGATGGAGAAGGCCTTCAAGAAGCGATTCCTTGTCCGCTACGATCACGAGCTGTTTCCCGAGACTTCAACAAAGAAAGACA
AAGCCAAATGA
	
	
MNTSLAVISHAPHRFLSLTKVIKCFLELKHPIDKYYDERLQLSNLMSSLKEELRQLYSLIAPLNTMSAAAPLQVTRPSRDKNGESKEDAFFVEHHMLEKT
VRKFRRLMEKAFKKRFLVRYDHELFPETSTKKDKAK_