Scaffold : scaffold_9
Gene_id : Plaha_PHALS_14877
Description : hypothetical protein
TTCGCGCAATTCATCGTCTCAATTAGCTCCTTCGTTTGAGAACAACTCAGCTGGTTCCTCGGTACTATCGCCAAAAGTATTCATATCTAGAATCATGGAA
TGCAGTCCAACCAGAACGTCATAGAGACAATTGGTTGTTGTAACAAGGTTTCAATACGAGATTTAAACAACACATTCAAGGGGAACGACGATGAAGGAGC
TATTTCGACGAATTTTAACTTGATGGCTGTCATTTTTAATGCTGAGAGAATAGTCTTAGATCAGCAAAGAAGTCTATAGCAGCCAGGACTTTAATCCTTC
ACCCTTACCAAGCAAATAGTTATAAACAGAACGCAATCTGAATATTCAGATCATAGCCGCGTCATGAACTGTCAATGATTCTATGACTCTCTTTTTGTGT
ACGTAGAATGATTTGGTTTGATAAATCGACAATTACTTTTACAGTGCTTAAAAAACGTGCTAGTATCGTCACGAATTGCCCTTTGCGAAGCTTTAACTTG
TAACGCCAGCTTCAACAACCACACGAGGGTTGACACCATACGCTGC
	
	
ATGCAGTCCAACCAGAACGTCATAGAGACAATTGGTTGTTGTAACAAGGTTTCAATACGAGATTTAAACAACACATTCAAGGGGAACGACGATGAAGGAG
CTATTTCGACGAATTTTAACTTGATGGCTGTCATTTTTAATGCTGAGAGAATAGTCTTAGATCAGCAAAGAAGTCTATAG
	
	
MQSNQNVIETIGCCNKVSIRDLNNTFKGNDDEGAISTNFNLMAVIFNAERIVLDQQRSL_