Scaffold : scaffold_3
Gene_id : Plaha_PHALS_12809
Description : hypothetical protein
ATGAAGTCGAAGGAGGGCGAGGCTGTCGCGGTAGCGCGCGATGTCAGTGGCGACGTCACGCTGTCCGGTGCGTTTTCCTATCTACGTTGTCGTTCGTTTC
GTTTGATGTTGATGTGCAGAACGCCTCAATTTTCTTCTACTGGCTCACACAAAGCGCTCTAATTGTTGTGTGATTGTGTTCCATCAGGCCCAGGCTCAGC
TGCGGAAGGCCATGAGGTGGCCGACCACCAGCTCTTCGCAAATACTGATGAAGCCGCCGTGGATCCGACTGGACCAGCTATGAAGAAGCAACTGGAACAA
AGTGTCGTGTTGCACAAGGATGAAGAAGCTATGTCTAATGTAGATACTATCCGAACAGAGCTTCAATTCGGACAGTCAGACACATTGACGATCAGAGAGC
TCAATGCCGAATTGCAAATGACGGCAGATAAGGCAACACAGGAGGAAATGAGAGTTTTGGTCTTGCAGGAAGAAAACCACCGTCTCATGAACCAGATTGC
GGCTGTTTTGGAGGATAAACAACAGTGGGAACGGCTTACACAACAACTCACAGATGACAATCACGCGCAACGTCTTAAATTAAAGGAATTAACACAGGAG
CTTCATAGTGCCAAACAGGAGCGTGAGGACATCGAGCAGATGTATCTGGAAGTGTCTTCCAATTTTGAGCAGGCGTTACGAAGCAATAATGAACTTGAGA
AGGAGCGAAGCGTAGCTTTGTCTAAGATTGACTCGGAAAGACGACTCAAAATGTTTGAAAAAACTACCAGGCAAGAAATGTTGCAGCTCAATCAGCAGAT
TCAGTCACTCATTGCGTCCAATGACAGGACTACAGCAGATCTTGCCGAAACTACGGCGATTCGGGAAAAAGTGCTTGAAAAATTTGGTGTTGACCTTACG
TACGAGAATATCGAGTCACTTCTTGACGTGAAAAACAAGGAAATTCAGATGCTCATAGAGCAGCAGTCGGCTATGGAAATTTCCCATGAACAAGCCATTC
GTGAGACCGTCAACGTTACCGTTGCTGAAGTTGAGCGGCACCAGCTTAGTTTCGAGACGATTCCATTGCAGTACGATACTTTGGTAACCGAAAACAACGA
GCAAAATTACGCAGTGAAGGATTTGTATCTGAAGTTGGAACACTTTGCCAACGAGCACGCAATCTTGCAGGAAATGCATCAGCGAATGTGCAAAGAAAAG
GATGAGCAGATTGAGCAGCTAATTGGACAGCTTGATGCTGCTCAGACTCAGACACAGCAGTTTGATAAAGACTTTCTTACgatcaaaattaaaattgaag
GGTTGAATGAAGCGCTACAGATAGGAAACCCGCCATATACCGAGTTCAATACTAAGCTTACAATACTAGACGAGCTTGAGGCGCATCTAGACCACATCGA
AAAACAGCTCGTAGGCTCCACAAAATCACTTCTGATTCATCCTCAAAGTGAATCAAAGACTCTCCAAGTACGTATCAAAAAGTGCGAGGAAGAAAAACAG
CAGCTGATCGTAAAACTTGAAGAGTGTGAAGCTGCTTTAAAGGCTCGTGCAAGCGAATTTGACTTGCTCATAGCGCGGGGGCGAGCTGATAGTCCTGGTG
ATGACAAGTGTACATTTTTGCACGACAAAAATGCATCCGTTGAAACTTCAGATAGCTCTACTGGAACCTTGTGCAGTTTTGAGCGAGATTTGGAAGTCAT
GAAGGCTCAGCTGCATTCATGTCACGCACAGATGACTGCATATAAAGCTGAAAACATTCGAATGATTTTTGAAATGGCAAAAACAGCTGATAACGCCTCG
AAGTTTAAGCAAAATTATGAGGATTTACAAAAGACGCTCGCAATGAAATCCTTGAAGCTAGATTCGACGTTGGAGCAACTGAAGGTTTTAAAATCTGCAA
ATAAGACGCTAGAGTCAGATGTTTTAAGGATATACGAGGAGATGCGTTGCGGCTCCGAAGCGTTTGCAATGCAAAGTGAGGAATTCGAGTCCGTGACTGC
TAGATTGAGTCTTGCTTTAACAAAAACTGAAAAGAAAAGCCAAAAGCTAAAACGCGACTTAGAGGATATGAAGACTGAAAATAACGTTTTGGAGGAGCGA
ATTGCTGAACTAGTCGTGGTAGACTCTAACTTTGAAGGAGATGACGAACAAAAAATGGACCATGAGGTTCAAAAACTGCGTTCGTCACTAGTTCAAGCTA
AAGTCAGGTATTTGGAACAAAAGTCGCAGCTTACTGCTCTAGAAAAGAAATTGGTGCAGGTCTCGAGGCCAAGTGGTCCTGCGCTTACAACTAGTAGTGT
TTCATTGGATGCAGAGCGACGGGAATTCGAAGCAGCCTTGATCGAGATGATTGAGATGGAGAAAAAACTTCAGTTAGCTTACGAGGCAAAGCAAGGCCTG
GAGTTGACACTTCAGGAGCGGATGGAGGCAAAGAAAGATCTAGAAGGTCGGCTTTTAATTGCAGAAGACAAGATAGTCGAGTTGGAGCAACAGCTAGAGC
AGAAATCTGCTTTTATCGCTACAATTAAAGAGCAGCTGCAAAAGGTGGAAAATGAGCGTGAAAAATTGATAGAAGACTTTGCCAGGACTAATTCGAAGCT
GGAACGCAGTAACGGCAGGCTAGAGGAGAAAGTGATCGAATTTGAGACATTAAAAACAACGACTGCTATGCTGAAGGATGAGCGCAGTCGTCTCTTCAGT
GAGATCGCACTGCTGaaagaaaatattttcaaatttgaagcaCACAAAGTGGAAATAAGAGACTCTCAAGAGCTTGAGAATGAAGAGCTGGTGGAGCAGC
TAAACGAGCTTGCTGATAAAATTGCTGAGATTGAGTCAGAAAAGCAGGAACTTTGTGCTAGACTTGAACAAACAGTTCAGCGATCTGAAGAAGATATTCA
CCAATTAAGAGAACGGCTGTACATGCTTGAGGAGGAAAAATCAGGACTTGACGAAGAAAATTACCAACTTGAGAGGACTGTTGATCAGTTAGGATCTGAA
TTGattttgctcaaagagcagaaGGTGGGCCTTGAAGTAGCAAACACGTTGATCTCTCAGCAGTTAAATCTTTTGGAGCAACATATGGAGAATGCAACAG
GTGACATCGCCAGTTTATCAGCCGAAAAGAGAAAATTTATTGAGCTACAACAATCACTTGAGGCGCGAGTGTCTGCTTTTGAGGCTGAAAAGATTGAGCG
TGAGCACGATTTCGATATAACGACGGCCAGATTGCACGAGgaattggctcaggcctcGAATAACGTCAAAGCTCTGCAGTTTCAGCTTGTTCAAAGTGTT
GCAGAGAATGAAAAGATCACGGCGTCCCTTTTGGAATATCAAAGAAATGCTCAGGACGACAAATTGGCGAGTAAAAATATCGCCATGAAACTGGAAAAGC
AAGTAGCAGAGAACCACGATCTAAAGAAAAAAGTTGTAGCATTAAAACAAATGGCAGAAAAGGCATTGCATTCGCTACAAGCTAAATGTGAGGAGCTATC
TGAAGCGGAATCCCGTGTTGCTGTGCTGATTGAAGATTGTGATGTGACCAAACTATCGCTGTCGGAAAAGCAGTCGGCGTATGATAAGCTTGCTCTTCAC
TGTGAAATTTCCATGCAACAGATTGACAAGCTATCCGGTGAACTAAGTGATTGGCAGACGAGGTATACTGAAGAAGCTCGCGTAGCTGAGGAGGTTATTT
GCGCTTTGAAGAAAAACGAAAGCACATTAGAGGGGTCGCTGGCATCTGTTCAACAAGACTTGGCAAAAGCAGTGGAAGAACGAGATGCGGCATTGAAGGA
TGTCACCGCGAAGGATCTAAAAATCGAGATTTTGAAGTCTCAGCAAAGCGAACTCGAACGTGCGACTCATAGGCTTGATAGTGAGTCAAAAAGGCTACAG
TCGAAGATTGTCTTTGATGCAAAAGCCACGGACGATATGATTTGTCGGTTTGAAAAATCAAACTTGGAAGCAGACCAAACTATCCGCAACCTGTCGGATT
TATACGAACAAGCCCAAGTGTCCTATCAGGCAATTCAAGATCAGCTAGTCGACTCAGAAACGCGATTTTCTGTTCTTAAAGAGGAACGTGATACCTTAAG
AACGTATCTGGATGAGAAGGAGTCAAATCACGACATGCTCAGTGCCCAAAAGATAGATTTGCAAAAGAAAATTAGTGTTTTAAAAACGGAACTGGAAAAC
GTTCGCAAAACGAGTTTAACCGAGCTGAATGCTGCGAAAGAGACCATTGCAAGCCTAAAAGCTGCCCAAGCTGAAGAAGCAAGGTTTACTGCGTCAGTTC
AAGAGGAATTATCACAGGCTGAAGGATGTGTAATAGTTCTTGTTGAGGAGCGAGATGCTGCGAAAAAGTTActaagcaaaagagaatTCGCCCTAGAAGT
TCTCAGCTCTGAGCATGGCGAGCTACAATTGAAGCATCAATCGGTTACCACTGAACTGGAAACTTTGAAACGCAAAATTGCAGCGGATGCCAAAGTTGTA
GAGGCGACGGTCAATAAGTCGAAAAAAGAAGTGACAGAGGCAACAAATTCCTTAAAAGCAGTGCAAGCCGAGCTAATAAAAGCCGAGTCCCGAGTGATTT
CCCTAGCTGCAGAATGCGAAACAGTAGGAAAAGCGTTTGACGAGCTGGAGACAAAGCACGAGTCACTGAGCTCTGTTAATGAAAACCTGACTGTGCAGCT
TGAGAGCTTACAAGTTTCTATGGGGAATTTGCGCAGACAACATTTGGTTGAGCTTGAGGCCGCACAAGAGAAGATCCGTGACATGGAAATGGTGGATGCA
ACGAAGACCAAAACGCACGAATTAGCTCGTCTACAGCTATTAGACGAGAATTCGCGGGTCGTCTTCTTGACTGCAGAACTTAGCGACAAGGAAACTACTG
CAAAAATGCTAAAGCTTCAAGTTGAAGAGCTGCATATGCGCATCCAGTCACTAGAGAGTGAGTTGGAGGAGCTGCAACACCAGCGTGAAGCGGAGACTGA
GGCGGCAGAGAAGACCATTTGCAGCTTAAAGGCTTCAGAATCACAGTCCAGTGAGGAACTCGAGTCAATACGTCAGGAGGTTGCTGAGCTGGAGGCGCGT
CTTGTGTCTACAGAGAAGGAGCGTGAGATTGTCAGCATGACTTTGAGCGAAATGGAGTCTCAGTGCAATGCTCAAAGCACAGAAATGTTATCCATGCAGA
CACGTATCCAGTCACTTGAGAGTGAGTTAGAGGAGCTGCTACACCAGCGTGAAGCGGAGACTGAGACGGCAGAAAAGACTATTTGCAGCTTGAAAGCTTT
GGAATCACAGTCCAGTGAGGCACTCGAGGCAATACGTCAGGAGTTTGCTGAGCTGGAGGCGCGTCTTGTGACTACAGAGAAGGAGCGTGAGACCGTCAGC
ATGACCTTAAGCGAGACCGAGTCGCACTGCAACGCTCAAGGAATAGAAATGTNNNNNNNNNNTATTCATCTGGCCAAGATGTTTAGGATAAAGTCGGACT
TGAAGAGCTACGACTACGACGTCAAGGATATCATCATGAGGCAGGTGATGCTGGACAGTCTTCCTGACCTGTATGAGTATGAGCAGGTGCGCGGAGCAGT
GAAGTATGGGCGTTCTGCGGAGATGACCCCGGATGGACTCCGGGCGTTGATTGAACAAGCGGCTGTGAAACAGTCACTTCGCGGCAAGGAAATCGCACCA
CTAATACAGGTAGTGGCCAACGGCTGCAGCAAGGAGACAGCACAGGTGCTCGCCATCAACAACAAGATGGGCAAAATGGGAGCAAGAAAAATCAGCACGG
TGATGGCCAGCGAAAACCGAAGCGTGACAGGAAGAACAAAATTTGTCACCGGTGCAATGAGATCGGTCACTTCCAGGCTGACTGTACAGCTATTATCGAT
GATGTTGCTGGGCCTGGTGTGGCTATCCGCCAGTGGTGGCAACTCTGGGACGAACGCTGAAACGCAACGGCGTCAGCAGCGCTCCAACTACACGAGTCGC
GGCGGCGAAGTCCGGGCGGACAGGCGTGGAGTTGTTGAAGATGAGCAAGGTGTGGCTGCTGTTGTTGCGATGGTCAGTCCGATGCTGGCCGTTCCGGACA
CGAAGAGCGAGGATGACAATATGGCCAAGTCGCTACCAGGAGGTGGTGTTTCGACACAGGTTCCAATGTGCACTTG
	
	
ATGAAGTCGAAGGAGGGCGAGGCTGTCGCGGTAGCGCGCGATGTCAGTGGCGACGTCACGCTGTCCGGCCCAGGCTCAGCTGCGGAAGGCCATGAGGTGG
CCGACCACCAGCTCTTCGCAAATACTGATGAAGCCGCCGTGGATCCGACTGGACCAGCTATGAAGAAGCAACTGGAACAAAGTGTCGTGTTGCACAAGGA
TGAAGAAGCTATGTCTAATGTAGATACTATCCGAACAGAGCTTCAATTCGGACAGTCAGACACATTGACGATCAGAGAGCTCAATGCCGAATTGCAAATG
ACGGCAGATAAGGCAACACAGGAGGAAATGAGAGTTTTGGTCTTGCAGGAAGAAAACCACCGTCTCATGAACCAGATTGCGGCTGTTTTGGAGGATAAAC
AACAGTGGGAACGGCTTACACAACAACTCACAGATGACAATCACGCGCAACGTCTTAAATTAAAGGAATTAACACAGGAGCTTCATAGTGCCAAACAGGA
GCGTGAGGACATCGAGCAGATGTATCTGGAAGTGTCTTCCAATTTTGAGCAGGCGTTACGAAGCAATAATGAACTTGAGAAGGAGCGAAGCGTAGCTTTG
TCTAAGATTGACTCGGAAAGACGACTCAAAATGTTTGAAAAAACTACCAGGCAAGAAATGTTGCAGCTCAATCAGCAGATTCAGTCACTCATTGCGTCCA
ATGACAGGACTACAGCAGATCTTGCCGAAACTACGGCGATTCGGGAAAAAGTGCTTGAAAAATTTGGTGTTGACCTTACGTACGAGAATATCGAGTCACT
TCTTGACGTGAAAAACAAGGAAATTCAGATGCTCATAGAGCAGCAGTCGGCTATGGAAATTTCCCATGAACAAGCCATTCGTGAGACCGTCAACGTTACC
GTTGCTGAAGTTGAGCGGCACCAGCTTAGTTTCGAGACGATTCCATTGCAGTACGATACTTTGGTAACCGAAAACAACGAGCAAAATTACGCAGTGAAGG
ATTTGTATCTGAAGTTGGAACACTTTGCCAACGAGCACGCAATCTTGCAGGAAATGCATCAGCGAATGTGCAAAGAAAAGGATGAGCAGATTGAGCAGCT
AATTGGACAGCTTGATGCTGCTCAGACTCAGACACAGCAGTTTGATAAAGACTTTCTTACgatcaaaattaaaattgaagGGTTGAATGAAGCGCTACAG
ATAGGAAACCCGCCATATACCGAGTTCAATACTAAGCTTACAATACTAGACGAGCTTGAGGCGCATCTAGACCACATCGAAAAACAGCTCGTAGGCTCCA
CAAAATCACTTCTGATTCATCCTCAAAGTGAATCAAAGACTCTCCAAGTACGTATCAAAAAGTGCGAGGAAGAAAAACAGCAGCTGATCGTAAAACTTGA
AGAGTGTGAAGCTGCTTTAAAGGCTCGTGCAAGCGAATTTGACTTGCTCATAGCGCGGGGGCGAGCTGATAGTCCTGGTGATGACAAGTGTACATTTTTG
CACGACAAAAATGCATCCGTTGAAACTTCAGATAGCTCTACTGGAACCTTGTGCAGTTTTGAGCGAGATTTGGAAGTCATGAAGGCTCAGCTGCATTCAT
GTCACGCACAGATGACTGCATATAAAGCTGAAAACATTCGAATGATTTTTGAAATGGCAAAAACAGCTGATAACGCCTCGAAGTTTAAGCAAAATTATGA
GGATTTACAAAAGACGCTCGCAATGAAATCCTTGAAGCTAGATTCGACGTTGGAGCAACTGAAGGTTTTAAAATCTGCAAATAAGACGCTAGAGTCAGAT
GTTTTAAGGATATACGAGGAGATGCGTTGCGGCTCCGAAGCGTTTGCAATGCAAAGTGAGGAATTCGAGTCCGTGACTGCTAGATTGAGTCTTGCTTTAA
CAAAAACTGAAAAGAAAAGCCAAAAGCTAAAACGCGACTTAGAGGATATGAAGACTGAAAATAACGTTTTGGAGGAGCGAATTGCTGAACTAGTCGTGGT
AGACTCTAACTTTGAAGGAGATGACGAACAAAAAATGGACCATGAGGTTCAAAAACTGCGTTCGTCACTAGTTCAAGCTAAAGTCAGGTATTTGGAACAA
AAGTCGCAGCTTACTGCTCTAGAAAAGAAATTGGTGCAGGTCTCGAGGCCAAGTGGTCCTGCGCTTACAACTAGTAGTGTTTCATTGGATGCAGAGCGAC
GGGAATTCGAAGCAGCCTTGATCGAGATGATTGAGATGGAGAAAAAACTTCAGTTAGCTTACGAGGCAAAGCAAGGCCTGGAGTTGACACTTCAGGAGCG
GATGGAGGCAAAGAAAGATCTAGAAGGTCGGCTTTTAATTGCAGAAGACAAGATAGTCGAGTTGGAGCAACAGCTAGAGCAGAAATCTGCTTTTATCGCT
ACAATTAAAGAGCAGCTGCAAAAGGTGGAAAATGAGCGTGAAAAATTGATAGAAGACTTTGCCAGGACTAATTCGAAGCTGGAACGCAGTAACGGCAGGC
TAGAGGAGAAAGTGATCGAATTTGAGACATTAAAAACAACGACTGCTATGCTGAAGGATGAGCGCAGTCGTCTCTTCAGTGAGATCGCACTGCTGaaaga
aaatattttcaaatttgaagcaCACAAAGTGGAAATAAGAGACTCTCAAGAGCTTGAGAATGAAGAGCTGGTGGAGCAGCTAAACGAGCTTGCTGATAAA
ATTGCTGAGATTGAGTCAGAAAAGCAGGAACTTTGTGCTAGACTTGAACAAACAGTTCAGCGATCTGAAGAAGATATTCACCAATTAAGAGAACGGCTGT
ACATGCTTGAGGAGGAAAAATCAGGACTTGACGAAGAAAATTACCAACTTGAGAGGACTGTTGATCAGTTAGGATCTGAATTGattttgctcaaagagca
gaaGGTGGGCCTTGAAGTAGCAAACACGTTGATCTCTCAGCAGTTAAATCTTTTGGAGCAACATATGGAGAATGCAACAGGTGACATCGCCAGTTTATCA
GCCGAAAAGAGAAAATTTATTGAGCTACAACAATCACTTGAGGCGCGAGTGTCTGCTTTTGAGGCTGAAAAGATTGAGCGTGAGCACGATTTCGATATAA
CGACGGCCAGATTGCACGAGgaattggctcaggcctcGAATAACGTCAAAGCTCTGCAGTTTCAGCTTGTTCAAAGTGTTGCAGAGAATGAAAAGATCAC
GGCGTCCCTTTTGGAATATCAAAGAAATGCTCAGGACGACAAATTGGCGAGTAAAAATATCGCCATGAAACTGGAAAAGCAAGTAGCAGAGAACCACGAT
CTAAAGAAAAAAGTTGTAGCATTAAAACAAATGGCAGAAAAGGCATTGCATTCGCTACAAGCTAAATGTGAGGAGCTATCTGAAGCGGAATCCCGTGTTG
CTGTGCTGATTGAAGATTGTGATGTGACCAAACTATCGCTGTCGGAAAAGCAGTCGGCGTATGATAAGCTTGCTCTTCACTGTGAAATTTCCATGCAACA
GATTGACAAGCTATCCGGTGAACTAAGTGATTGGCAGACGAGGTATACTGAAGAAGCTCGCGTAGCTGAGGAGGTTATTTGCGCTTTGAAGAAAAACGAA
AGCACATTAGAGGGGTCGCTGGCATCTGTTCAACAAGACTTGGCAAAAGCAGTGGAAGAACGAGATGCGGCATTGAAGGATGTCACCGCGAAGGATCTAA
AAATCGAGATTTTGAAGTCTCAGCAAAGCGAACTCGAACGTGCGACTCATAGGCTTGATAGTGAGTCAAAAAGGCTACAGTCGAAGATTGTCTTTGATGC
AAAAGCCACGGACGATATGATTTGTCGGTTTGAAAAATCAAACTTGGAAGCAGACCAAACTATCCGCAACCTGTCGGATTTATACGAACAAGCCCAAGTG
TCCTATCAGGCAATTCAAGATCAGCTAGTCGACTCAGAAACGCGATTTTCTGTTCTTAAAGAGGAACGTGATACCTTAAGAACGTATCTGGATGAGAAGG
AGTCAAATCACGACATGCTCAGTGCCCAAAAGATAGATTTGCAAAAGAAAATTAGTGTTTTAAAAACGGAACTGGAAAACGTTCGCAAAACGAGTTTAAC
CGAGCTGAATGCTGCGAAAGAGACCATTGCAAGCCTAAAAGCTGCCCAAGCTGAAGAAGCAAGGTTTACTGCGTCAGTTCAAGAGGAATTATCACAGGCT
GAAGGATGTGTAATAGTTCTTGTTGAGGAGCGAGATGCTGCGAAAAAGTTActaagcaaaagagaatTCGCCCTAGAAGTTCTCAGCTCTGAGCATGGCG
AGCTACAATTGAAGCATCAATCGGTTACCACTGAACTGGAAACTTTGAAACGCAAAATTGCAGCGGATGCCAAAGTTGTAGAGGCGACGGTCAATAAGTC
GAAAAAAGAAGTGACAGAGGCAACAAATTCCTTAAAAGCAGTGCAAGCCGAGCTAATAAAAGCCGAGTCCCGAGTGATTTCCCTAGCTGCAGAATGCGAA
ACAGTAGGAAAAGCGTTTGACGAGCTGGAGACAAAGCACGAGTCACTGAGCTCTGTTAATGAAAACCTGACTGTGCAGCTTGAGAGCTTACAAGTTTCTA
TGGGGAATTTGCGCAGACAACATTTGGTTGAGCTTGAGGCCGCACAAGAGAAGATCCGTGACATGGAAATGGTGGATGCAACGAAGACCAAAACGCACGA
ATTAGCTCGTCTACAGCTATTAGACGAGAATTCGCGGGTCGTCTTCTTGACTGCAGAACTTAGCGACAAGGAAACTACTGCAAAAATGCTAAAGCTTCAA
GTTGAAGAGCTGCATATGCGCATCCAGTCACTAGAGAGTGAGTTGGAGGAGCTGCAACACCAGCGTGAAGCGGAGACTGAGGCGGCAGAGAAGACCATTT
GCAGCTTAAAGGCTTCAGAATCACAGTCCAGTGAGGAACTCGAGTCAATACGTCAGGAGGTTGCTGAGCTGGAGGCGCGTCTTGTGTCTACAGAGAAGGA
GCGTGAGATTGTCAGCATGACTTTGAGCGAAATGGAGTCTCAGTGCAATGCTCAAAGCACAGAAATGTTATCCATGCAGACACGTATCCAGTCACTTGAG
AGTGAGTTAGAGGAGCTGCTACACCAGCGTGAAGCGGAGACTGAGACGGCAGAAAAGACTATTTGCAGCTTGAAAGCTTTGGAATCACAGTCCAGTGAGG
CACTCGAGGCAATACGTCAGGAGTTTGCTGAGCTGGAGGCGCGTCTTGTGACTACAGAGAAGGAGCGTGAGACCATGTTTAGGATAAAGTCGGACTTGAA
GAGCTACGACTACGACGTCAAGGATATCATCATGAGGCAGGTGATGCTGGACAGTCTTCCTGACCTGTATGAGTATGAGCAGGTGCGCGGAGCAGTGAAG
TATGGGCGTTCTGCGGAGATGACCCCGGATGGACTCCGGGCGTTGATTGAACAAGCGGCTGTGAAACAGTCACTTCGCGGCAAGGAAATCGCACCACTAA
TACAGGTAGTGGCCAACGGCTGCAGCAAGGAGACAGCACAGGTGCTCGCCATCAACAACAAGATGGGCAAAATGGGAGCAAGAAAAATCAGCACGGTGAT
GGCCAGCGAAAACCGAAGCGTGACAGGAAGAACAAAATTTGTCACCGGTGCAATGAGATCGGTCACTTCCAGGCTGACTGTACAGCTATTATCGATGATG
TTGCTGGGCCTGGTGTGGCTATCCGCCAGTGGTGGCAACTCTGGGACGAACGCTGAAACGCAACGGCGTCAGCAGCGCTCCAACTACACGAGTCGCGGCG
GCGAAGTCCGGGCGGACAGGCGTGGAGTTGTTGAAGATGAGCAAGGTGTGGCTGCTGTTGTTGCGATGGTCAGTCCGATGCTGGCCGTTCCGGACACGAA
GAGCGAGGATGACAATATGGCCAAGTCGCTACCAGGAGGTGGTGTTTCGACACAGGTTCCAATGTGCACTTGA
	
	
MKSKEGEAVAVARDVSGDVTLSGPGSAAEGHEVADHQLFANTDEAAVDPTGPAMKKQLEQSVVLHKDEEAMSNVDTIRTELQFGQSDTLTIRELNAELQM
TADKATQEEMRVLVLQEENHRLMNQIAAVLEDKQQWERLTQQLTDDNHAQRLKLKELTQELHSAKQEREDIEQMYLEVSSNFEQALRSNNELEKERSVAL
SKIDSERRLKMFEKTTRQEMLQLNQQIQSLIASNDRTTADLAETTAIREKVLEKFGVDLTYENIESLLDVKNKEIQMLIEQQSAMEISHEQAIRETVNVT
VAEVERHQLSFETIPLQYDTLVTENNEQNYAVKDLYLKLEHFANEHAILQEMHQRMCKEKDEQIEQLIGQLDAAQTQTQQFDKDFLTIKIKIEGLNEALQ
IGNPPYTEFNTKLTILDELEAHLDHIEKQLVGSTKSLLIHPQSESKTLQVRIKKCEEEKQQLIVKLEECEAALKARASEFDLLIARGRADSPGDDKCTFL
HDKNASVETSDSSTGTLCSFERDLEVMKAQLHSCHAQMTAYKAENIRMIFEMAKTADNASKFKQNYEDLQKTLAMKSLKLDSTLEQLKVLKSANKTLESD
VLRIYEEMRCGSEAFAMQSEEFESVTARLSLALTKTEKKSQKLKRDLEDMKTENNVLEERIAELVVVDSNFEGDDEQKMDHEVQKLRSSLVQAKVRYLEQ
KSQLTALEKKLVQVSRPSGPALTTSSVSLDAERREFEAALIEMIEMEKKLQLAYEAKQGLELTLQERMEAKKDLEGRLLIAEDKIVELEQQLEQKSAFIA
TIKEQLQKVENEREKLIEDFARTNSKLERSNGRLEEKVIEFETLKTTTAMLKDERSRLFSEIALLKENIFKFEAHKVEIRDSQELENEELVEQLNELADK
IAEIESEKQELCARLEQTVQRSEEDIHQLRERLYMLEEEKSGLDEENYQLERTVDQLGSELILLKEQKVGLEVANTLISQQLNLLEQHMENATGDIASLS
AEKRKFIELQQSLEARVSAFEAEKIEREHDFDITTARLHEELAQASNNVKALQFQLVQSVAENEKITASLLEYQRNAQDDKLASKNIAMKLEKQVAENHD
LKKKVVALKQMAEKALHSLQAKCEELSEAESRVAVLIEDCDVTKLSLSEKQSAYDKLALHCEISMQQIDKLSGELSDWQTRYTEEARVAEEVICALKKNE
STLEGSLASVQQDLAKAVEERDAALKDVTAKDLKIEILKSQQSELERATHRLDSESKRLQSKIVFDAKATDDMICRFEKSNLEADQTIRNLSDLYEQAQV
SYQAIQDQLVDSETRFSVLKEERDTLRTYLDEKESNHDMLSAQKIDLQKKISVLKTELENVRKTSLTELNAAKETIASLKAAQAEEARFTASVQEELSQA
EGCVIVLVEERDAAKKLLSKREFALEVLSSEHGELQLKHQSVTTELETLKRKIAADAKVVEATVNKSKKEVTEATNSLKAVQAELIKAESRVISLAAECE
TVGKAFDELETKHESLSSVNENLTVQLESLQVSMGNLRRQHLVELEAAQEKIRDMEMVDATKTKTHELARLQLLDENSRVVFLTAELSDKETTAKMLKLQ
VEELHMRIQSLESELEELQHQREAETEAAEKTICSLKASESQSSEELESIRQEVAELEARLVSTEKEREIVSMTLSEMESQCNAQSTEMLSMQTRIQSLE
SELEELLHQREAETETAEKTICSLKALESQSSEALEAIRQEFAELEARLVTTEKERETMFRIKSDLKSYDYDVKDIIMRQVMLDSLPDLYEYEQVRGAVK
YGRSAEMTPDGLRALIEQAAVKQSLRGKEIAPLIQVVANGCSKETAQVLAINNKMGKMGARKISTVMASENRSVTGRTKFVTGAMRSVTSRLTVQLLSMM
LLGLVWLSASGGNSGTNAETQRRQQRSNYTSRGGEVRADRRGVVEDEQGVAAVVAMVSPMLAVPDTKSEDDNMAKSLPGGGVSTQVPMCT_