Scaffold : Scaffold_2292
Gene_id : Phyta_totarag14336
Description : hypothetical protein
ATGCCTTTGGTCAACGCCGATGTGGACGTCCCCAAACGCCTGTCGTTCTTGAGTACTGGCTTGCAGACGAAAGACATTGAAGACGGCTATATCGGACTCA
AAACACCCGAAATCGACGGTGGAGCCCTCCGCGAAGGAGGTATGCCTGTGCTCACCAGCAGGGACAACCTCGGACCTCTCTTCTAGTACGCCACTGTCGG
TCTTGTCTACGGTTTGCTACCCGAAACGATCTACCCGTTCATGCAGAACTACCTCAACTGCTCTGGAGCTCAAGTGACTGCAGTTCAGCAACTTATCGTG
CTACCGTGGAGTTTCAAGGTCTTCTACGGCATTCTGTCCGACTGCCGACCCATTTTCGGCTATCGGCGCCGCCCATACATGCTCATCGGCTGGGGTATCT
GTTTCATTATGTTGTTGATCATGGCCATCATGCCTATCGGTCAACCGTACTTCACTGTTGCTTCGGACCGCGACATCGACATTGCCGACTACACACCAGA
AATCGAAGCCCGTCTTAACCACAACGCCCCCGACGATGGCGCCAAGTACGTCATCATCAtgctgtttgctgctgtcgggTACGTGTTGGCCGATGTCTGC
GCAGACAGTATCACGTGCGAGTTGGCTCAACGCGAGCCTATTGACAAGCGCGGCAAAACACAGTCCTGTATTTACACGGTCCGAACTGCGATGGTGATCT
TCGGCGAGATCCTAGtgggtttcttcttcaacggcGAAGATTATGGaggcgacttcgacttctcgCTCAGTTTTCCGCAGTTGATGATCATCGTAGCAGT
GCTTACACTTCCAGTGTTCCCGATGACGTGGTTCTTcatcaaggaggagaaaTCCTCGGCCGCGAACTTCAAGGAGTACATGAAGAGCTTCTGGGACTTG
TTGTGCTCCCGCGCCATGTACCAGATCATCGCCTACCTGTTCTTTTCCGGCATCTTCGCCAACATCACGTACACTGGTAGCTCTCCAGTGGCATCGAAAA
TGGTGGGCGTCACCCCAATCAACAGCACATTGAGTAGTATTCTCAGCAACCTCTTGTTCGCCGCAGGAATCATGATCACTTCGAAGTGGGGTCTGCACTG
GAACTGGCGCTGGATGACCGTCGTCACTGGAGTtgtggtggtcgtcgtggaCTGCACAGTGTCGCTTCTTGTTATCTGGGACGTCTTCCGGAGCCAGTGG
TTCTGGCTGGGTCCCCCCATTGCGGTGCAACTTCCGTACGGCGTCGGCTGGATCATTTCGACGTTCTGCGTGGTCGAGCTCGCTCAAATCGGAAATGAAG
CTGCGGTCTACGGCCTAGTTACCACGGTCACCAATGTGGCTCAGCCTTTTGCGACGTCACTAACCCTTGCGATCGATGGTCCGTTCAGCGTCACAAACGA
AAGAGTGCAGGCCGATGACCACTCGGTTCGTGCCGACATCACGTacaccatcatcatcatgtACGCCATGACCATCTTCTCGTGGGTTTTCCACTTCCTG
CTGCCTCCACAGAAGGCGGAAACGCAGGAACTCGTGCGCAAGGGTGGACACAGCAAGCTTATCGGTGGCGTCACAGCGTTCTacctcatcttcgccatct
ttTGGTCCATTATGACCAACATCATGGCCATGTTCGACAGTACGTCGTGCTTGATCATTGCAGGTGGAACCGGTTGCTAATACAAAGACCAAGTTACACG
ACGGTCCGTCCTTGACAATCTCGAAAGACGTAGTACATGCAGTTTAATGTTTGTAGTCCACGTTTCGTTCGAGGATACGCTCTTGCTGTGTGATGCTTGG
TACAGTACCTTGTTGTTGAAGCCATAACCCACTATAATAGAAAAACAGCGACTTGCCGAATCGTAAAAttgtcgacgaagatgctACTTTTTACAGTATG
TATCAGCTGCGCGGATCTCGTCACgtcagctacatgtacgtgaATACATGTGCCTCCGTGAATTTGATGTGCAAGCGAGAGCAACTTCGACCCAGCTTTG
TGAGTACAGTATCAAGGATCAAAAGGAGACTGAAAAAAGAGCCTGGAACAAGCGTTGGATGATCGTCATCTGTGGTAATCATTGTCGATTGCCCCGTAAC
GACGATTGTCGTCTGGGAGATTCTGTCTTGGCCCTCCCATTGCTGAACAGCCCCCGGCTGGCGTTGGCTGGATCATCTCGTCGTTTGTGACAGTGGAGCT
CGAGGGACTACCGGTAGGCAACCAAGCTGTAGTCTACGGTCTACTCACGACCGTCACAATATTGCATCGCCGTTTGCATCGGCGTTGACACTCGTGATCG
ACGCTCCGTTCAACATCACCAACGCGCGCGTCCAAGAAGACGACTACACCATTCGCAGGGACCTCACCTACACTATCATCATCATGTACGCCATGACAGC
CTTTGCGTggagcttcttgttcttgctaccgaagcagaaggaggacacACAGCGACTCCTGCGCAAGGGGGGCAAGAGCAAACTCATCGGCGGCATCACG
ATCTTCTATCTGTG
	
	
ATGCCTTTGGTCAACGCCGATGTGGACGTCCCCAAACGCCTGTCGTTCTTGAGTACTGGCTTGCAGACGAAAGACATTGAAGACGGCTATATCGGACTCA
AAACACCCGAAATCGACGGTGGAGCCCTCCGCGAAGGAGTTCAGCAACTTATCGTGCTACCGTGGAGTTTCAAGGTCTTCTACGGCATTCTGTCCGACTG
CCGACCCATTTTCGGCTATCGGCGCCGCCCATACATGCTCATCGGCTGGGGTATCTGTTTCATTATGTTGTTGATCATGGCCATCATGCCTATCGGTCAA
CCGTACTTCACTGTTGCTTCGGACCGCGACATCGACATTGCCGACTACACACCAGAAATCGAAGCCCGTCTTAACCACAACGCCCCCGACGATGGCGCCA
AGTACGTCATCATCAtgctgtttgctgctgtcgggTACGTGTTGGCCGATGTCTGCGCAGACAGTATCACGTGCGAGTTGGCTCAACGCGAGCCTATTGA
CAAGCGCGGCAAAACACAGTCCTGTATTTACACGGTCCGAACTGCGATGGTGATCTTCGGCGAGATCCTAGtgggtttcttcttcaacggcGAAGATTAT
GGaggcgacttcgacttctcgCTCAGTTTTCCGCAGTTGATGATCATCGTAGCAGTGCTTACACTTCCAGTGTTCCCGATGACGTGGTTCTTcatcaagg
aggagaaaTCCTCGGCCGCGAACTTCAAGGAGTACATGAAGAGCTTCTGGGACTTGTTGTGCTCCCGCGCCATGTACCAGATCATCGCCTACCTGTTCTT
TTCCGGCATCTTCGCCAACATCACGTACACTGGTAGCTCTCCAGTGGCATCGAAAATGGTGGGCGTCACCCCAATCAACAGCACATTGAGTAGTATTCTC
AGCAACCTCTTGTTCGCCGCAGGAATCATGATCACTTCGAAGTGGGGTCTGCACTGGAACTGGCGCTGGATGACCGTCGTCACTGGAGTtgtggtggtcg
tcgtggaCTGCACAGTGTCGCTTCTTGTTATCTGGGACGTCTTCCGGAGCCAGTGGTTCTGGCTGGGTCCCCCCATTGCGGTGCAACTTCCGTACGGCGT
CGGCTGGATCATTTCGACGTTCTGCGTGGTCGAGCTCGCTCAAATCGGAAATGAAGCTGCGGTCTACGGCCTAGTTACCACGGTCACCAATGTGGCTCAG
CCTTTTGCGACGTCACTAACCCTTGCGATCGATGGTCCGTTCAGCGTCACAAACGAAAGAGTGCAGGCCGATGACCACTCGGTTCGTGCCGACATCACGT
acaccatcatcatcatgtACGCCATGACCATCTTCTCGTGGGTTTTCCACTTCCTGCTGCCTCCACAGAAGGCGGAAACGCAGGAACTCGTGCGCAAGGG
TGGACACAGCAAGCTTATCGGTGGCGTCACAGCGTTCTacctcatcttcgccatctttTGGTCCATTATGACCAACATCATGGCCATGTTCGACACCCCC
GGCTGGCGTTGGCTGGATCATCTCGTCGTTTGTGACAGTGGAGCTCGAGGGACTACCGGTAGGCAACCAAGCTGTAGTCTACGGTCTACTCACGACCGTC
ACAATATTGCATCGCCGTTTGCATCGGCGTTGACACTCGTGATCGACGCTCCGTTCAACATCACCAACGCGCGCGTCCAAGAAGACGACTACACCATTCG
CAGGGACCTCACCTACACTATCATCATCATGTACGCCATGACAGCCTTTGCGTggagcttcttgttcttgctaccgaagcagaaggaggacacACAGCGA
CTCCTGCGCAAGGGGGGCAAGAGCAAACTCATCGGCGGCATCACGATCTTCTATCTGTGA
	
	
MPLVNADVDVPKRLSFLSTGLQTKDIEDGYIGLKTPEIDGGALREGVQQLIVLPWSFKVFYGILSDCRPIFGYRRRPYMLIGWGICFIMLLIMAIMPIGQ
PYFTVASDRDIDIADYTPEIEARLNHNAPDDGAKYVIIMLFAAVGYVLADVCADSITCELAQREPIDKRGKTQSCIYTVRTAMVIFGEILVGFFFNGEDY
GGDFDFSLSFPQLMIIVAVLTLPVFPMTWFFIKEEKSSAANFKEYMKSFWDLLCSRAMYQIIAYLFFSGIFANITYTGSSPVASKMVGVTPINSTLSSIL
SNLLFAAGIMITSKWGLHWNWRWMTVVTGVVVVVVDCTVSLLVIWDVFRSQWFWLGPPIAVQLPYGVGWIISTFCVVELAQIGNEAAVYGLVTTVTNVAQ
PFATSLTLAIDGPFSVTNERVQADDHSVRADITYTIIIMYAMTIFSWVFHFLLPPQKAETQELVRKGGHSKLIGGVTAFYLIFAIFWSIMTNIMAMFDTP
GWRWLDHLVVCDSGARGTTGRQPSCSLRSTHDRHNIASPFASALTLVIDAPFNITNARVQEDDYTIRRDLTYTIIIMYAMTAFAWSFLFLLPKQKEDTQR
LLRKGGKSKLIGGITIFYL_