Scaffold : Scaffold_680
Gene_id : Phyta_totarag10137
Description : hypothetical protein
ATGCCCCCACCAACACTCACCATAGGAAGTCTCAGTGCATTCGCATCGGGGTCGCCCCTGGAGCGGTCATTTTTGTCGTCATCTTTGCGATCGTCTCCGT
CAAAGCAGGGCAAGGCTTCTCCAGTTCGAGTACCGCAGAAAAGCTTCGGTCGCCAACCAGCTCGAGTAGCCGCTGCACCTGCCTCGCCCgttgctcctgc
tccagcatcagTTGTAGCTCAGTCCGATGACGACTTGTCCAGCTTAACGCTCAGTCTTGATGACACCGAGTTTGTCCATGGACTTCACCAGGAGATCGCG
CGAGACTGGCCAATGATAGAAAACGCAGTCAACCATAAGCGAGAGAATACGAAGCTACGAGCCGAGATTGAGGTTCTGCggcaagagctgcaagagctgc
aagaccTTCGCGATTCCAGCACAAAGGTGACTCCTTGCGTACGATGGCTTCGTGGTTGGCACGACTTATTTAACTGACAGGAGTGCATCGTCGTCCATCT
GAACAGAACGATGACGTTTGGCAGCGTGAGAATGCTCGTCTAAAGGAACAGCTCACCGCAGCAAACACACGCGAAGTAACACAAcaggagcagctccgtg
tccaTGACGAGCGACTTGCATTGTGCCGTCAAGAGCTTCTTGAGTTGCAAGAGCACCAGCTGAAAGATGAGCAAGAGCAAACAGCCCCTTTGCACCCTCC
TGCCGAAGAGGTCGCTATTAGTTCAGGGCTCGGGCGAGAGCGtgagttgctgaagctcgtcgtccagttGGTAGGTGGCGCAAACGTTCGTGCTGTGCTC
CACGAGAACCCAACCGCCAGCCCCGCCCAACTCCGCGAAGCCATCGTCCGTCTACGCTGCCCGCAATGCCGCCGTCTGTCACCACCGTCGCGAACTCGTA
TACTCGGGAGCGGCCACACCGAAAGTCTCCACAAAATGCTGTTCGGGACGTCTTCCagatctccttctccaacaGCGATCCGCTTCAACTCGATGGGTAT
TGATCCCCACTCAAGTAAACAGTAGGGCAATACAAAAGCAAACTACGGCAATGTTATCCAAGTACGATTGAGATCTCCTTTGCTGCAACATATGGACCCA
GACCATCCTTGCCCCTGTGTCTACGGCATTTGCCTTGAATCAACACAGCTACCGTAATTTAGGTGTTAAGTGTCCGCCTttgttaagtgtcaccccaACC
GACAACACCCCAATAGCAGCCCACACCAACCTCAAACAACCCCAGCAGTAGCATAAGAGACGAGGGTGGCGATACGTGTAGGAAGCCGGCAGCCAAACTA
ACGCACTACCAGGATGAAGTGTTGTTGCTAACacatatacatgtatctgaTTTTGCACGTTGAATTTATCCTGATCTTGGGGTTTGTGTGCACGCTGGGG
GTGACACTTGACACCTAGATTACGGTATTACCAATTCAGGATGGCCAGCGCGACTCGAGCGGGTTCGAGCATGACCATCGACCTGGGCACGACGTTCGCT
CGTGGGAGTGTGGGAGAGCTATAACGTGACGATCATTGAGAACGAGCAGGGCAACTGCCTGGCCCCTGCGTGCATCACTCCTCCCTCCCAACTGCCATGA
AGTTCTTCCAggtcttcatcatcgccgCCCTCGCCGTCTTCGGACAGGCAGTCAccacacagcaacagcagctacTACAACCGGGCCTTCCTGTACTTCT
AGGTCCGAAAACCTGCGTCCGACAGCCCGTGCATTGCCGAACacgatgttgctgcattgctgtccacttcaacttcaacttgaacagGACTAATTGTGGT
AATAGTCAATCACCACCATATTTACACTTGCTGTCACTAAAATAATCACCATATGCACACTACCCGTCATCAACCCCTTGGGTATCAAAACTTCAGAAGT
caatgagcagcagcgaggcaGAGGAGGCCGTGGCCTCCAGAGGCCTCACCGTCGGTAACTACGCGTCCTCTCAACTTGCATCCACTCTCAATTTCTTCCC
CACTCACTCCGCAACCTGTTAACATGCTTTCACGCAGTGGAAGAGGCCACCAATCGCCACGCAGAGCTGTTCGAAGAGTTCCCGGAGCCCGAAGTGAAGA
AAGTGTCGCGATTGGAGCGGGAGAAGAAAGAGCTGGCCAACCGCTCGCTCGTGTACGGAGAGATCCCGTTCGAGACGGTGGACGCCATTTTTCAGCTGGT
ACCGAGGCTCAAAAGGCAGTCAAAATAGGGCTGTCACGGGGAGGATCTGACTGACTGCACtgactgttgctgctgttgccagATGAGGACGCAGTTCGGA
GTGCTTCTGGATAAAGGAGGGAACTTCTACGACATTGGCTCGGGCTGTGGCAAAGTGGTGGGTGCAGAGGACTTGATGCTGGAGAGTTATGGGGCTCTAA
TGATGGGGAACTGATGGAGACAGTGGGCTGTGGATGGCAGGTGATGGCGGCCGTATTGCTGCATGACTTCTCCAAGTGCTGCGGCATTGAGGTAAGTTAA
GAGGGGCTACTGGGGCGGGATGAGAATTGGTGAGAGATGTGCAGCTGAGTGTGGAGGGATATTTGGGCTGTATGTAGGTGTTGGATGGACTACACGCGGT
ggcgctgaaggtgctggatcGGTGGCGATACCAGATGCTGGACTCGCTGCCGGCGACCAAGGTTGATGTCGATGTGGGCTTTGTTAAAGGAGATGCTGTG
AAGCGGCCTGATATCTGGCGGGACGCTACACTTGTGTTTTGCAACTCGACCTGCTTCAGCGACAGCGTAGgttcaagttgctgtctgGTAACGCATTTGG
AGTGTTTTAGGCGTGCTCATTATCTGCATTGCTTTTGTTGATATATGAGCAGCTTATTCAAGCAATTTCAACTGAAGCAGGTTCATGATGTTCCACGATG
CGCTTGGGACAAAAAAATATTGCCGTCTAACTGTTGTTTGTATTCCTTTTGTGGATCCAGACCAATTGGCTGTGGGCAGCTACTTTGTGACGGTGACCAA
GCCGTTGCAGTCTACACGATGGCAGGCGATGCATGAGGAAAAGTTTCACATGAGCTGGGGGCGCGCGACTGTCATTGtccagaagaagatgttCTA
	
	
ATGCCCCCACCAACACTCACCATAGGAAGTCTCAGTGCATTCGCATCGGGGTCGCCCCTGGAGCGGTCATTTTTGTCGTCATCTTTGCGATCGTCTCCGT
CAAAGCAGGGCAAGGCTTCTCCAGTTCGAGTACCGCAGAAAAGCTTCGGTCGCCAACCAGCTCGAGTAGCCGCTGCACCTGCCTCGCCCgttgctcctgc
tccagcatcagTTGTAGCTCAGTCCGATGACGACTTGTCCAGCTTAACGCTCAGTCTTGATGACACCGAGTTTGTCCATGGACTTCACCAGGAGATCGCG
CGAGACTGGCCAATGATAGAAAACGCAGTCAACCATAAGCGAGAGAATACGAAGCTACGAGCCGAGATTGAGGTTCTGCggcaagagctgcaagagctgc
aagaccTTCGCGATTCCAGCACAAAGGTGACTCCTTGCAACGATGACGTTTGGCAGCGTGAGAATGCTCGTCTAAAGGAACAGCTCACCGCAGCAAACAC
ACGCGAAGTAACACAAcaggagcagctccgtgtccaTGACGAGCGACTTGCATTGTGCCGTCAAGAGCTTCTTGAGTTGCAAGAGCACCAGCTGAAAGAT
GAGCAAGAGCAAACAGCCCCTTTGCACCCTCCTGCCGAAGAGGTCGCTATTAGTTCAGGGCTCGGGCGAGAGCGtgagttgctgaagctcgtcgtccagt
tGGTAGGTGGCGCAAACGTTCGTGCTGTGCTCCACGAGAACCCAACCGCCAGCCCCGCCCAACTCCGCGAAGCCATCGTCCTGGAAGAGGCCACCAATCG
CCACGCAGAGCTGTTCGAAGAGTTCCCGGAGCCCGAAGTGAAGAAAGTGTCGCGATTGGAGCGGGAGAAGAAAGAGCTGGCCAACCGCTCGCTCGTGTAC
GGAGAGATCCCGTTCGAGACGGTGGACGCCATTTTTCAGCTGATGAGGACGCAGTTCGGAGTGCTTCTGGATAAAGGAGGGAACTTCTACGACATTGGCT
CGGGCTGTGGCAAAGTGGTGATGGCGGCCGTATTGCTGCATGACTTCTCCAAGTGCTGCGGCATTGAGGTGTTGGATGGACTACACGCGGTggcgctgaa
ggtgctggatcGGTGGCGATACCAGATGCTGGACTCGCTGCCGGCGACCAAGGTTGATGTCGATGTGGGCTTTGTTAAAGGAGATGCTGTGAAGCGGCCT
GATATCTGGCGGGACGCTACACTTGTGTTTTGCAACTCGACCTGCTTCAGCGACAGCGTAGACCAATTGGCTGTGGGCAGCTACTTTGTGACGGTGACCA
AGCCGTTGCAGTCTACACGATGGCAGGCGATGCATGAGGAAAAGTTTCACATGAGCTGGGGGCGCGCGACTGTCATTGtccagaagaagatgttCTAG
	
	
MPPPTLTIGSLSAFASGSPLERSFLSSSLRSSPSKQGKASPVRVPQKSFGRQPARVAAAPASPVAPAPASVVAQSDDDLSSLTLSLDDTEFVHGLHQEIA
RDWPMIENAVNHKRENTKLRAEIEVLRQELQELQDLRDSSTKVTPCNDDVWQRENARLKEQLTAANTREVTQQEQLRVHDERLALCRQELLELQEHQLKD
EQEQTAPLHPPAEEVAISSGLGRERELLKLVVQLVGGANVRAVLHENPTASPAQLREAIVLEEATNRHAELFEEFPEPEVKKVSRLEREKKELANRSLVY
GEIPFETVDAIFQLMRTQFGVLLDKGGNFYDIGSGCGKVVMAAVLLHDFSKCCGIEVLDGLHAVALKVLDRWRYQMLDSLPATKVDVDVGFVKGDAVKRP
DIWRDATLVFCNSTCFSDSVDQLAVGSYFVTVTKPLQSTRWQAMHEEKFHMSWGRATVIVQKKMF_